I am working in Excel 2003 SP1, and am using a VLookup function that has
worked beautifully until last friday.  My function references a named range
on a different sheet within the same workbook, but I am now getting error
messages for some lookups, and not others.

How can I protect a worksheet so that people can not destroy the formulas in
certain cells but make it so the list still activates?

I have a very large mailing list in an excel format with duplicates and
triplicates that I would like to dedupe.

~Oh gods of formulas, please help me!!!  Can you help me with this
formula?~
If a cell in column a equals a cell in column f then insert in
column b the number in column g.  

I got the below data that I need to find the ultimate result after comparing
multiple logical_tests.  I had tried using IF, OR, AND, MATCH command, but to
no avail.
Hope some of you can give me some suggestion as to what other command that I

I am running this lookup function but can't get the correct result,
anyone know what I am doing wrong
=LOOKUP(AI61,{"NearExactExactExact","ExactNearExactExact","ExactNearExactDifferent","ExactDifferentExactExact","ExactDifferentExactDifferent","ExactAbsentExactExact" ...

I'm new to excel spreadsheets, and would like to know what to do when value
comes up in the totals column

I need help on this project; conditional formatting does not work on different sheets and I do not know how
to change the formulas or what formula to use, that will work please help.
B1 this CELL equals  09/04/2006
Sheet1     D5    E5             F5       G5  H5  I5  J5  K5  L5  M5

i recieved a quiz. there are pictures and you have to name that film. You
type your answer in the box and then if you get the right answer the box
turns green if not its wrong the box turns red.
If you think you can help me please email me and i will email you the quiz

I need some serious help with my restaurant/bar schedule.  I am trying to
program the sheet to do the following things:
*count # of scheduled servers for day shift and night shift separately to
make sure we are sufficiently staffed for each shift

Hi People,
I have a sequence of characters like:
AASSASDKASASDASFAFSASASADKASASAFPKQREWEAQEOKSPADAOEKOQPPDAOPSKAEPQ
This sequence must be put in cell A2.

I'm trying to create a database on sheet 2, say from 1-40 names.  i would
like to type in a numeric number (lets say #8) into sheet 1 say G, 4:  I
would like the name from sheet 2 posted from say #8 to be posted into cell G5?
How do i do this?

I have an assignment that I can not get completed for the life of me.
Here is the situation: Apply conditional formatting to your workshee
so that those people who are below average in sales should have thei
NAMES formatted in red, italics, and bold.

I have two columns of importance in the same sheet one is acct numbers, the
other is a date.  I want to produce a sheet that shows the acct number once
and then displays which date coincide with it.  for instance:
acct # | date | date | date |

I want to look in column A and column B for matching part numbers and in
column C have a formula that will display any part number from column A that
is not in column B. I have 3450 part numbers to go through as new numbers are
added every week.